PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do008246.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 251aa    MW: 25257.3 Da    PI: 9.3018
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do008246.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof103.31.4e-3281135559
      zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                  ++cprC+s+ntkfCyynnys +qPry+CkaCrr+Wt+GG+lr+vPvGggr++++
  Do008246.1  81 PRQCPRCQSANTKFCYYNNYSRAQPRYLCKACRRHWTEGGTLRDVPVGGGRKNRR 135
                 679*********************************************9976544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.2E-3082134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.02182136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-1689127IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MPSSFLASAS SSASSPLSYL IPVSRPPPPP SFVMGQGYSV DGLAGVSMCS VVDAAAAVAP  60
PRQGARNAGG AGHPPLPRPP PRQCPRCQSA NTKFCYYNNY SRAQPRYLCK ACRRHWTEGG  120
TLRDVPVGGG RKNRRAGKGG GAAAKASAAS AAAATQQGGG VAVVGADTFP DLLRHQVQFQ  180
PAAAAVGGGG GGYAIDLRAW QQMAAATAPP PHGAGDVSAL GGAAAAEANC GALQYWGGWQ  240
QDDMPGLDGA C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279851e-122KJ727985.1 Zea mays clone pUT6101 C2C2-DOF transcription factor (DOF13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982733.12e-66PREDICTED: dof zinc finger protein PBF-like isoform X1
TrEMBLB6TQH82e-61B6TQH8_MAIZE; Putative uncharacterized protein
STRINGSi040117m1e-56(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.12e-18Dof family protein